What is the catalog number for CHEK1 Peptide - middle region?

The catalog number for CHEK1 Peptide - middle region is orb2003396.

What sizes are available for CHEK1 Peptide - middle region?

CHEK1 Peptide - middle region is available in the following size(s): 100 µg.

Is CHEK1 Peptide - middle region in stock?

CHEK1 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

CHEK1 Peptide - middle region

Product Specifications

UniProt

O14757

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001107593

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SPVNSASSEENVKYSSSQPEPRTGLSLWDTSPSYIDKLVQGISFSQPTCP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FT108329-01 5 mg

N-[ (2RS,3RS) -2,3,4-Trihydroxy-butyl]-Val-Leu-anilide

Sign In for Pricing

View Details

FT108329-02 10 mg

N-[ (2RS,3RS) -2,3,4-Trihydroxy-butyl]-Val-Leu-anilide

Sign In for Pricing

View Details

FT108329-03 25 mg

N-[ (2RS,3RS) -2,3,4-Trihydroxy-butyl]-Val-Leu-anilide

Sign In for Pricing

View Details

FT108329-04 50 mg

N-[ (2RS,3RS) -2,3,4-Trihydroxy-butyl]-Val-Leu-anilide

Sign In for Pricing

View Details

FT108329-05 100 mg

N-[ (2RS,3RS) -2,3,4-Trihydroxy-butyl]-Val-Leu-anilide

Sign In for Pricing

View Details

C00543H 100 µL

NCR1 Antibody HRP Conjugated

Sign In for Pricing

View Details