Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHEK1 Peptide - middle region

CHEK1 Peptide - middle region

Product Specifications

UniProt

O14757

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001107593

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SPVNSASSEENVKYSSSQPEPRTGLSLWDTSPSYIDKLVQGISFSQPTCP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human GSAP Protein, N-His
orb3063339-01 50 µg

Recombinant Human GSAP Protein, N-His

Sign In for Pricing
View Details
Recombinant Human GSAP Protein, N-His
orb3063339-02 100 µg

Recombinant Human GSAP Protein, N-His

Sign In for Pricing
View Details
Recombinant Human GSAP Protein, N-His
orb3063339-03 1 mg

Recombinant Human GSAP Protein, N-His

Sign In for Pricing
View Details
AIK3 Antibody Blocking peptide
orb1444992 500 µg

AIK3 Antibody Blocking peptide

Sign In for Pricing
View Details
Calcium Levofolinate EP Impurity G
RM-L051525-01 10 mg

Calcium Levofolinate EP Impurity G

Sign In for Pricing
View Details
Calcium Levofolinate EP Impurity G
RM-L051525-02 25 mg

Calcium Levofolinate EP Impurity G

Sign In for Pricing
View Details