Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAF6 Peptide - C-terminal region

TRAF6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC:3310, RNF85

UniProt

Q9Y4K3

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_004611

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FGYVTFMHLEALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZCCHC11 Antibody
orb1246769 0.1 mg

ZCCHC11 Antibody

Sign In for Pricing
View Details
C2orf42 Double Nickase Plasmid (h)
sc-408896-NIC 20 µg

C2orf42 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
ZCCHC12 3'UTR GFP Stable Cell Line
TU078779 1.0 mL

ZCCHC12 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Bysl (NM_016859) Mouse Recombinant Protein
PM44299M5 20 µg

Bysl (NM_016859) Mouse Recombinant Protein

Sign In for Pricing
View Details
OOCA00453-25T - Human COX4I1 Primer Pair 2
OOCA00453-25T 25 Tests

OOCA00453-25T - Human COX4I1 Primer Pair 2

Sign In for Pricing
View Details
A 70874
orb1698820 25 mg

A 70874

Sign In for Pricing
View Details