Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAF6 Peptide - C-terminal region

TRAF6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC:3310, RNF85

UniProt

Q9Y4K3

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_004611

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FGYVTFMHLEALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DPYS (Dihydropyrimidinase, DHP, DHPase, Dihydropyrimidine Amidohydrolase, Hydantoinase) (FITC)
126006-FITC 100 µL

DPYS (Dihydropyrimidinase, DHP, DHPase, Dihydropyrimidine Amidohydrolase, Hydantoinase) (FITC)

Sign In for Pricing
View Details
PEAR1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
36366061 1.0 µg DNA

PEAR1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
IAH1 Rabbit Polyclonal Antibody
TA359286 100 µL

IAH1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Monoclonal antibody to MAVS (Clone: ABM28H9)
10-4061-25 25 µg

Monoclonal antibody to MAVS (Clone: ABM28H9)

Sign In for Pricing
View Details
Hsa-miR-1537-3p miRNA Antagomir
orb1915475-01 10 nmol

Hsa-miR-1537-3p miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-1537-3p miRNA Antagomir
orb1915475-02 20 nmol

Hsa-miR-1537-3p miRNA Antagomir

Sign In for Pricing
View Details