What is the catalog number for ADRB1 Peptide - C-terminal region?

The catalog number for ADRB1 Peptide - C-terminal region is orb2003394.

What sizes are available for ADRB1 Peptide - C-terminal region?

ADRB1 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is ADRB1 Peptide - C-terminal region in stock?

ADRB1 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

ADRB1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ADRB1R, B1AR, BETA1AR, RHR

UniProt

P08588

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_000675

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

orb2083104 100 µL

SIRT3 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing

View Details

K2596805 3x 1.0 µg

USP7 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing

View Details

CAU32847-01 100 µL

Gonadotropin Releasing Hormone (GnRH) Monoclonal Antibody

Sign In for Pricing

View Details

CAU32847-02 200 µL

Gonadotropin Releasing Hormone (GnRH) Monoclonal Antibody

Sign In for Pricing

View Details

CAU32847-03 1 mL

Gonadotropin Releasing Hormone (GnRH) Monoclonal Antibody

Sign In for Pricing

View Details

MG224186 10 µg

Pou2f1 (NM_198932) Mouse Tagged ORF Clone

Sign In for Pricing

View Details