Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CX3CL1 Peptide - middle region

CX3CL1 Peptide - middle region

Product Specifications

UniProt

Q6I9S9

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: APHQPGPSLWAEAKTSEAPSTQDPSTQASTASSPAPEENAPSEGQRVWGQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Acetylethanolamine (~90%)
TRC-A284830-500MG 500 mg

N-Acetylethanolamine (~90%)

Sign In for Pricing
View Details
Human SH2D4A activation kit by CRISPRa
GA111904 1 Kit

Human SH2D4A activation kit by CRISPRa

Sign In for Pricing
View Details
Fmoc-Ala TentaGel® S AC Resin
SA1101.5G 5 g

Fmoc-Ala TentaGel® S AC Resin

Sign In for Pricing
View Details
Stradb Mouse Gene Knockout Kit (CRISPR)
KN516908 1 Kit

Stradb Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DAP5 (EIF4G2) Rabbit Polyclonal Antibody
AP20486PU-N 100 µg

DAP5 (EIF4G2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human SAP30L activation kit by CRISPRa
GA112548 1 Kit

Human SAP30L activation kit by CRISPRa

Sign In for Pricing
View Details