Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CX3CL1 Peptide - middle region

CX3CL1 Peptide - middle region

Product Specifications

UniProt

Q6I9S9

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: APHQPGPSLWAEAKTSEAPSTQDPSTQASTASSPAPEENAPSEGQRVWGQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLHL3 Human Gene Knockout Kit (CRISPR)
KN418393 1 Kit

KLHL3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD99 (MIC2/877), CF488A conjugate, 0.1mg/mL
BNC880877-500 1x 500 µL

CD99 (MIC2/877), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cardiac Troponin I Antibody (HRP)
KH-198-01 50 μL

Cardiac Troponin I Antibody (HRP)

Sign In for Pricing
View Details
Cardiac Troponin I Antibody (HRP)
KH-198-02 100 µL

Cardiac Troponin I Antibody (HRP)

Sign In for Pricing
View Details
Cardiac Troponin I Antibody (HRP)
KH-198-03 1 mL

Cardiac Troponin I Antibody (HRP)

Sign In for Pricing
View Details
Myeloid leukemia factor 1 (MLF1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C10]
TA800121BM 100 µL

Myeloid leukemia factor 1 (MLF1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C10]

Sign In for Pricing
View Details