Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LYL1 Peptide - C-terminal region

LYL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BHLHa18

UniProt

P12980

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LYL1 Rabbit Polyclonal Antibody (orb573700) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005574

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PDDGARRGSGRRAEAAARSQPAPPADPDGSPGGAARPIKMEQTALSPEVR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XRCC3 (10F1/6), CF740 conjugate, 0.1mg/mL
BNC742842-500 1x 500 µL

XRCC3 (10F1/6), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
(+/-)-Catechin xHydrate
TRC-C217520-500MG 500 mg

(+/-)-Catechin xHydrate

Sign In for Pricing
View Details
Recombinant USP22 Antibody
RC-15880-01 50 μL

Recombinant USP22 Antibody

Sign In for Pricing
View Details
Recombinant USP22 Antibody
RC-15880-02 100 µL

Recombinant USP22 Antibody

Sign In for Pricing
View Details
Recombinant USP22 Antibody
RC-15880-03 1 mL

Recombinant USP22 Antibody

Sign In for Pricing
View Details
Adenosine 5’-Diphosphate Ammonium Salt Hydrate
TRC-A281700-250MG 250 mg

Adenosine 5’-Diphosphate Ammonium Salt Hydrate

Sign In for Pricing
View Details