LYL1 Peptide - C-terminal region
LYL1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
BHLHa18
UniProt
P12980
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with LYL1 Rabbit Polyclonal Antibody (orb573700) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_005574
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PDDGARRGSGRRAEAAARSQPAPPADPDGSPGGAARPIKMEQTALSPEVR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LC422850 20 µg
Shugoshin (SGO1) (NM_001012412) Human Over-expression Lysate
Sign In for Pricing
View Details 
BNUB1859-100 1x 100 µL
Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (VWF/1859R), 0.2mg/mL
Sign In for Pricing
View Details 
BNC472387-100 1x 100 µL
SOX9 / SRY-box 9 (SOX9/2387), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details