Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kif3b Peptide - middle region

Kif3b Peptide - middle region

Product Specifications

UniProt

Q8BNH4

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KIF3B Rabbit Polyclonal Antibody (orb574874) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GGGEEEEEEGEEGEEDGDDKDDYWREQQEKLEIEKRAIVEDHSLVAEEKM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTBR-Tau243 Antibody
KC-44227-01 50 μL

MTBR-Tau243 Antibody

Sign In for Pricing
View Details
MTBR-Tau243 Antibody
KC-44227-02 100 µL

MTBR-Tau243 Antibody

Sign In for Pricing
View Details
MTBR-Tau243 Antibody
KC-44227-03 1 mL

MTBR-Tau243 Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Breast
CR559616 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details
LY6G6F Rabbit Polyclonal Antibody
AP55062PU-N 100 µg

LY6G6F Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human LIPI activation kit by CRISPRa
GA115728 1 Kit

Human LIPI activation kit by CRISPRa

Sign In for Pricing
View Details