Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kif3b Peptide - middle region

Kif3b Peptide - middle region

Product Specifications

UniProt

Q8BNH4

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KIF3B Rabbit Polyclonal Antibody (orb574874) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GGGEEEEEEGEEGEEDGDDKDDYWREQQEKLEIEKRAIVEDHSLVAEEKM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOX2 (Transcription Factor) (SOX2/1792), CF488A conjugate, 0.1mg/mL
BNC881792-500 1x 500 µL

SOX2 (Transcription Factor) (SOX2/1792), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Fibroadipose tissue
CS807676 5x 5 µm

Tissue FFPE Sections, Fibroadipose tissue

Sign In for Pricing
View Details
Recombinant Keratin 20 Monoclonal Antibody
AN301577L-01 50 µL

Recombinant Keratin 20 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Keratin 20 Monoclonal Antibody
AN301577L-02 100 µL

Recombinant Keratin 20 Monoclonal Antibody

Sign In for Pricing
View Details
CDCP1 Antibody
KC-4013-01 50 μL

CDCP1 Antibody

Sign In for Pricing
View Details
CDCP1 Antibody
KC-4013-02 100 µL

CDCP1 Antibody

Sign In for Pricing
View Details