Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Trim35 Peptide - middle region

Trim35 Peptide - middle region

Product Specifications

Product Name Alternative

0710005M05Rik, A430106H13Rik, AW046487, HLS5, Mair, NC8, mKIAA1098

UniProt

Q8C006

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Trim35 Rabbit Polyclonal Antibody (orb575088) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_084255

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AAGWLKVADDLTSVINHGYRVQVENPERFSSAPCLLGSQVFSKGSHSWEV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyp3a2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV678777 1.0 µg DNA

Cyp3a2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Lauryl glucose neopentyl glycol
257456-01 250 mg

Lauryl glucose neopentyl glycol

Sign In for Pricing
View Details
Lauryl glucose neopentyl glycol
257456-02 500 mg

Lauryl glucose neopentyl glycol

Sign In for Pricing
View Details
Lauryl glucose neopentyl glycol
257456-03 1 g

Lauryl glucose neopentyl glycol

Sign In for Pricing
View Details
Lauryl glucose neopentyl glycol
257456-04 2 g

Lauryl glucose neopentyl glycol

Sign In for Pricing
View Details
Lauryl glucose neopentyl glycol
257456-05 5 g

Lauryl glucose neopentyl glycol

Sign In for Pricing
View Details