Trim35 Peptide - middle region
Trim35 Peptide - middle region
Product Specifications
Product Name Alternative
0710005M05Rik, A430106H13Rik, AW046487, HLS5, Mair, NC8, mKIAA1098
UniProt
Q8C006
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Trim35 Rabbit Polyclonal Antibody (orb575088) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_084255
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AAGWLKVADDLTSVINHGYRVQVENPERFSSAPCLLGSQVFSKGSHSWEV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1334263-01 0.02 mg (E-Coli)
Recombinant Caenorhabditis elegans Uncharacterized protein C03B1.10 (C03B1.10)
Sign In for Pricing
View Details MBS1334263-02 0.1 mg (E-Coli)
Recombinant Caenorhabditis elegans Uncharacterized protein C03B1.10 (C03B1.10)
Sign In for Pricing
View Details MBS1334263-03 0.02 mg (Yeast)
Recombinant Caenorhabditis elegans Uncharacterized protein C03B1.10 (C03B1.10)
Sign In for Pricing
View Details MBS1334263-04 0.1 mg (Yeast)
Recombinant Caenorhabditis elegans Uncharacterized protein C03B1.10 (C03B1.10)
Sign In for Pricing
View Details MBS1334263-05 0.02 mg (Baculovirus)
Recombinant Caenorhabditis elegans Uncharacterized protein C03B1.10 (C03B1.10)
Sign In for Pricing
View Details MBS1334263-06 1 mg (E-Coli)
Recombinant Caenorhabditis elegans Uncharacterized protein C03B1.10 (C03B1.10)
Sign In for Pricing
View Details