Tnfaip1 Peptide - C-terminal region
Tnfaip1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
Edp1
UniProt
Q7TNY1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Tnfaip1 Rabbit Polyclonal Antibody (orb575442) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_891995
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LNVLLYETPRVPDNSLLEATSRSRSQASPSEDEDTFELRDRVRRIHVKRY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AP14728PU-N 400 µL
Bcl rambo (BCL2L13) (Center) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
ICH1044-5mg 5 mg
Anti-Mouse CD8a (53-6.7) In Vivo Antibody - Low Endotoxin
Sign In for Pricing
View Details 
TP304803L 1 mg
Osteopontin (SPP1) (NM_001040058) Human Recombinant Protein
Sign In for Pricing
View Details 
