Tnfaip1 Peptide - C-terminal region
Tnfaip1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
Edp1
UniProt
Q7TNY1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Tnfaip1 Rabbit Polyclonal Antibody (orb575442) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_891995
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LNVLLYETPRVPDNSLLEATSRSRSQASPSEDEDTFELRDRVRRIHVKRY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB3493-100 1x 100 µL
PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3493), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041662-100 1x 100 µL
CD31 / PECAM-1 (Endothelial Cell Marker), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680015-500 1x 500 µL
CD56 / NCAM (123C3.D5), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![Cytokeratin 14 Recombinant Rabbit Monoclonal Antibody [SC65-06]](https://cdn.genprice.uk/products/992/68dd1c8d061270361ea81fcf/imageurl/et1610-42.webp)
ET1610-42 100 µL
Cytokeratin 14 Recombinant Rabbit Monoclonal Antibody [SC65-06]
Sign In for Pricing
View Details 