Kctd12 Peptide - C-terminal region
Kctd12 Peptide - C-terminal region
Product Specifications
Product Name Alternative
AU046135, AW538430, Pfet1, Pfetin
UniProt
Q6WVG3
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Kctd12 Rabbit Polyclonal Antibody (orb575477) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_808383
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PDRPPERYTSRYYLKFNFLEQAFDKLSESGFHMVACSSTGTCAFASSTDQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
P8950-26-ML490 100 µL
Prion Protein (PrP, Prnp, ASCR, Atal Familial Insomnia, CD230 Antigen, CJD, Creutzfeld Jakob Disease, Gerstmann-Strausler-Scheinker Syndrome, GSS, Major Prion Protein, MGC26679, Prion Related Protein, PRIP, Prni, PrP27-30, PrP33-35C, PrPC, PrPSc, Sinc) (MaxLight 490) discontinued
Sign In for Pricing
View Details ![Urocortin II, Human [H-Ile-Val-Leu-Ser-Leu-Asp-Val-Pro-Ile-gly-Leu-Leu-Gln-Ile-Leu-Leu-Glu-Gln-Ala-Arg-Ala-Arg-Ala-Ala-Arg-Glu-Gln-Ala-Thr-Thr-Asn-Ala-Arg-Ile-Leu-Ala-Arg-Val-Gly-His-Cys-NH2; MW: 4449.31]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
SP-55417-1 0.5 mg
Urocortin II, Human [H-Ile-Val-Leu-Ser-Leu-Asp-Val-Pro-Ile-gly-Leu-Leu-Gln-Ile-Leu-Leu-Glu-Gln-Ala-Arg-Ala-Arg-Ala-Ala-Arg-Glu-Gln-Ala-Thr-Thr-Asn-Ala-Arg-Ile-Leu-Ala-Arg-Val-Gly-His-Cys-NH2; MW: 4449.31]
Sign In for Pricing
View Details MBS1160689-01 0.02 mg (E-Coli)
Recombinant Campylobacter curvus Gamma-glutamyl phosphate reductase (proA)
Sign In for Pricing
View Details MBS1160689-02 0.02 mg (Yeast)
Recombinant Campylobacter curvus Gamma-glutamyl phosphate reductase (proA)
Sign In for Pricing
View Details MBS1160689-03 0.1 mg (E-Coli)
Recombinant Campylobacter curvus Gamma-glutamyl phosphate reductase (proA)
Sign In for Pricing
View Details