Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kctd12 Peptide - C-terminal region

Kctd12 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AU046135, AW538430, Pfet1, Pfetin

UniProt

Q6WVG3

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Kctd12 Rabbit Polyclonal Antibody (orb575477) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_808383

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PDRPPERYTSRYYLKFNFLEQAFDKLSESGFHMVACSSTGTCAFASSTDQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ROAA Antibody
C45974-01 50 μL

ROAA Antibody

Sign In for Pricing
View Details
ROAA Antibody
C45974-02 100 µL

ROAA Antibody

Sign In for Pricing
View Details
Hlf (NM_172563) Mouse Tagged ORF Clone Lentiviral Particle
MR204073L3V 200 µL

Hlf (NM_172563) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
AOAH shRNA Plasmid (h)
sc-89739-SH 20 µg

AOAH shRNA Plasmid (h)

Sign In for Pricing
View Details
hsa-miR-933 miRNA Agomir
MBS8311380-01 5 nmol

hsa-miR-933 miRNA Agomir

Sign In for Pricing
View Details
hsa-miR-933 miRNA Agomir
MBS8311380-02 10 nmol

hsa-miR-933 miRNA Agomir

Sign In for Pricing
View Details