Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kcng4 Peptide - middle region

Kcng4 Peptide - middle region

Product Specifications

UniProt

D4AD66

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Kcng4 Rabbit Polyclonal Antibody (orb575503) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001100905

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SDESPEAGERPSGSSYLEKVGLVLRVLRALRILYVMRLARHSLGLQTLGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VEGF Receptor 2 (KDR) Rabbit Polyclonal Antibody
AP02619PU-N 100 µL

VEGF Receptor 2 (KDR) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Natural Convection Incubator BINC-7801
BINC-7801 1 Unit

Natural Convection Incubator BINC-7801

Sign In for Pricing
View Details
PNCK (NM_001039582) Human Over-expression Lysate
LC432237 20 µg

PNCK (NM_001039582) Human Over-expression Lysate

Sign In for Pricing
View Details
p-(2,3-Epoxypropoxy)benzyl Alcohol
TRC-E589620-50MG 50 mg

p-(2,3-Epoxypropoxy)benzyl Alcohol

Sign In for Pricing
View Details
Ctla4 Mouse Gene Knockout Kit (CRISPR)
KN303962BN 1 Kit

Ctla4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Demephion
TRC-D231735-50MG 50 mg

Demephion

Sign In for Pricing
View Details