Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kcng4 Peptide - middle region

Kcng4 Peptide - middle region

Product Specifications

UniProt

D4AD66

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Kcng4 Rabbit Polyclonal Antibody (orb575503) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001100905

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SDESPEAGERPSGSSYLEKVGLVLRVLRALRILYVMRLARHSLGLQTLGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SERPINB12 Human Gene Knockout Kit (CRISPR)
KN420431 1 Kit

SERPINB12 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ketobemidone-d3
TRC-K175002-25MG 25 mg

Ketobemidone-d3

Sign In for Pricing
View Details
IL18BP (NM_001145057) Human Over-expression Lysate
LC428669 20 µg

IL18BP (NM_001145057) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Ckmt1 activation kit by CRISPRa
GA200741 1 Kit

Mouse Ckmt1 activation kit by CRISPRa

Sign In for Pricing
View Details
Screw-cap MicroCentrifuge Tubes
C3175-O 1000 Units/Case

Screw-cap MicroCentrifuge Tubes

Sign In for Pricing
View Details
Human Ryanodine Receptor 3 (RYR3) activation kit by CRISPRa
GA104245 1 Kit

Human Ryanodine Receptor 3 (RYR3) activation kit by CRISPRa

Sign In for Pricing
View Details