Wiz Peptide - C-terminal region
Wiz Peptide - C-terminal region
Product Specifications
UniProt
O88286
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Wiz Rabbit Polyclonal Antibody (orb329856) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_997603
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TSPPGTVKSEEHQRQNINKFERRQARPSDASAARGGEEVNDLQQKLEEVR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Rabbit Polyclonal APOB48R Antibody [Alexa Fluor 350]](https://cdn.genprice.uk/genprice/uk/genprice4.webp)
NBP2-98580AF350 0.1 mL
Rabbit Polyclonal APOB48R Antibody [Alexa Fluor 350]
Sign In for Pricing
View Details 
abx139218 100 Tests
T-Cell-Specific Surface Glycoprotein CD28 (CD28) Antibody (APC)
Sign In for Pricing
View Details 
GTR15352697 1 Vial
Lentiviral human TNN shRNA (UAS) - Lentiviral human TNN shRNA (UAS, iRFP) (25)
Sign In for Pricing
View Details MBS4382121-01 0.02 mg (With BSA & Azide at 0.2mg/mL)
LEF1/TCF1 alpha (Transcription Factor) Recombinant Mouse Monoclonal Antibody [Clone rLEF1/6906]
Sign In for Pricing
View Details MBS4382121-02 0.1 mg (With BSA & Azide at 0.2mg/mL)
LEF1/TCF1 alpha (Transcription Factor) Recombinant Mouse Monoclonal Antibody [Clone rLEF1/6906]
Sign In for Pricing
View Details MBS4382121-03 0.1 mg (Without BSA & Azide at 1mg/mL)
LEF1/TCF1 alpha (Transcription Factor) Recombinant Mouse Monoclonal Antibody [Clone rLEF1/6906]
Sign In for Pricing
View Details