Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wiz Peptide - C-terminal region

Wiz Peptide - C-terminal region

Product Specifications

UniProt

O88286

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Wiz Rabbit Polyclonal Antibody (orb329856) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997603

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TSPPGTVKSEEHQRQNINKFERRQARPSDASAARGGEEVNDLQQKLEEVR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGM2L1 Mouse Monoclonal Antibody [Clone ID: LBI4G6]
AMM20597V 100 µL

PGM2L1 Mouse Monoclonal Antibody [Clone ID: LBI4G6]

Sign In for Pricing
View Details
Mouse Monoclonal PON1 Antibody (4G8D3) [Alexa Fluor 750]
NBP2-23610AF750 0.1 mL

Mouse Monoclonal PON1 Antibody (4G8D3) [Alexa Fluor 750]

Sign In for Pricing
View Details
DBH Peptide
42-975P 0.1 mg

DBH Peptide

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 (Beta) S protein RBD, hFc Tag
32-17594-50 50 µg

Recombinant SARS-CoV-2 (Beta) S protein RBD, hFc Tag

Sign In for Pricing
View Details
D2HGDH (D2-Hydroxyglutarate Dehydrogenase, D2HGD)
362798 200 µL

D2HGDH (D2-Hydroxyglutarate Dehydrogenase, D2HGD)

Sign In for Pricing
View Details
(-) -Tylophorine
HY-122324A 1 Each

(-) -Tylophorine

Sign In for Pricing
View Details