Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZSCAN5A Peptide - middle region

ZSCAN5A Peptide - middle region

Product Specifications

Product Name Alternative

ZNF495, ZSCAN5

UniProt

Q9BUG6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZSCAN5A Rabbit Polyclonal Antibody (orb324627) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_077279

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QDSDIEMAEAPSSVRDDLKDVSSQRASSVNQMRPGEGQAHRELQILPRVP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cathepsin D HC Antibody
MBS5314237-01 0.1 mL

Cathepsin D HC Antibody

Sign In for Pricing
View Details
Cathepsin D HC Antibody
MBS5314237-02 5x 0.1 mL

Cathepsin D HC Antibody

Sign In for Pricing
View Details
CECR5 AAV Vector (Mouse) (CMV)
15842104 1 µg

CECR5 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Cys1 (NM_001004455) Mouse Tagged ORF Clone
MG218375 10 µg

Cys1 (NM_001004455) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
MTA2 Antibody
DF13292-01 100 µL

MTA2 Antibody

Sign In for Pricing
View Details
MTA2 Antibody
DF13292-02 200 µL

MTA2 Antibody

Sign In for Pricing
View Details