Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AGER, Human (HEK293, His)

AGER Protein, Human (HEK293, His) is human recombinant AGER with a His tag at the C-terminus. AGER Protein, Human (HEK293, His) is expressed by mammalian expression system and the target gene encoding Ala23-Ala344 is expressed.

Product Specifications

Product Name Alternative

AGER Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ager-protein-human-hek293-his.html

Purity

98.0

Smiles

AQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALA

Molecular Formula

177 (Gene_ID) Q15109 (A23-A344) (Accession)

Molecular Weight

Approximately 48-60 kDa due to the glycosylation.

References & Citations

[1]Biros E, et al. Association between the Advanced Glycosylation End Product-Specific Receptor Gene and Cardiovascular Death in Older Men. PLoS One. 2015 Jul 30;10 (7) :e0134475.|[2]Zee RY, et al. Polymorphisms in the advanced glycosylation end product-specific receptor gene and risk of incident myocardial infarction or ischemic stroke. Stroke. 2006 Jul;37 (7) :1686-90.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Isoastragaloside II
TB0509-0020 20mg

Isoastragaloside II

Sign In for Pricing
View Details
Recombinant Mycobacterium Smegmatis thiG Protein (aa 2-252)
VAng-Yyj4851-500gEcoli 500 µg (E. coli)

Recombinant Mycobacterium Smegmatis thiG Protein (aa 2-252)

Sign In for Pricing
View Details
2310050C09Rik (NM_025621) Mouse Tagged ORF Clone Lentiviral Particle
MR213070L4V 200 µL

2310050C09Rik (NM_025621) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Lentiviral mouse Ltb4r2 shRNA (UAS) - Lentiviral mouse Ltb4r2 shRNA (UAS) (100)
GTR15254394 1 Vial

Lentiviral mouse Ltb4r2 shRNA (UAS) - Lentiviral mouse Ltb4r2 shRNA (UAS) (100)

Sign In for Pricing
View Details
SYNPO2L (NM_001114133) Human Tagged Lenti ORF Clone
RC226285L3 10 µg

SYNPO2L (NM_001114133) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CheKine™ Micro Acetylcholinesterase (AchE) Activity Assay Kit
KTB1710 96 Tests - 96 Samples

CheKine™ Micro Acetylcholinesterase (AchE) Activity Assay Kit

Sign In for Pricing
View Details