Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AGER, Human (HEK293, His)

AGER Protein, Human (HEK293, His) is human recombinant AGER with a His tag at the C-terminus. AGER Protein, Human (HEK293, His) is expressed by mammalian expression system and the target gene encoding Ala23-Ala344 is expressed.

Product Specifications

Product Name Alternative

AGER Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ager-protein-human-hek293-his.html

Purity

98.0

Smiles

AQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALA

Molecular Formula

177 (Gene_ID) Q15109 (A23-A344) (Accession)

Molecular Weight

Approximately 48-60 kDa due to the glycosylation.

References & Citations

[1]Biros E, et al. Association between the Advanced Glycosylation End Product-Specific Receptor Gene and Cardiovascular Death in Older Men. PLoS One. 2015 Jul 30;10 (7) :e0134475.|[2]Zee RY, et al. Polymorphisms in the advanced glycosylation end product-specific receptor gene and risk of incident myocardial infarction or ischemic stroke. Stroke. 2006 Jul;37 (7) :1686-90.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Escherichia coli (strain K12) PHNI Polyclonal Antibody
MBS7153668 Inquire

Rabbit anti-Escherichia coli (strain K12) PHNI Polyclonal Antibody

Sign In for Pricing
View Details
NPM1 (Nucleophosmin (Nucleolar Phosphoprotein B23, Numatrin), B23, MGC104254, NPM)
249425 100 µg

NPM1 (Nucleophosmin (Nucleolar Phosphoprotein B23, Numatrin), B23, MGC104254, NPM)

Sign In for Pricing
View Details
Cdyl2 Mouse shRNA Lentiviral Particle (Locus ID 75796)
TL511134V 500 µL Each

Cdyl2 Mouse shRNA Lentiviral Particle (Locus ID 75796)

Sign In for Pricing
View Details
LentimiRa-Off-rno-miR-145-5p Vector
mr30098 500 ng

LentimiRa-Off-rno-miR-145-5p Vector

Sign In for Pricing
View Details
Goat V-Type Proton ATPase 16kDa Proteolipid Subunit (ATP6V0C) ELISA Kit
MBS9904888 Inquire

Goat V-Type Proton ATPase 16kDa Proteolipid Subunit (ATP6V0C) ELISA Kit

Sign In for Pricing
View Details
TCP11L2 ORF Vector (Human) (pORF)
ORF010399 1.0 µg DNA

TCP11L2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details