Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AGER, Human (HEK293, His)

AGER Protein, Human (HEK293, His) is human recombinant AGER with a His tag at the C-terminus. AGER Protein, Human (HEK293, His) is expressed by mammalian expression system and the target gene encoding Ala23-Ala344 is expressed.

Product Specifications

Product Name Alternative

AGER Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ager-protein-human-hek293-his.html

Purity

98.0

Smiles

AQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALA

Molecular Formula

177 (Gene_ID) Q15109 (A23-A344) (Accession)

Molecular Weight

Approximately 48-60 kDa due to the glycosylation.

References & Citations

[1]Biros E, et al. Association between the Advanced Glycosylation End Product-Specific Receptor Gene and Cardiovascular Death in Older Men. PLoS One. 2015 Jul 30;10 (7) :e0134475.|[2]Zee RY, et al. Polymorphisms in the advanced glycosylation end product-specific receptor gene and risk of incident myocardial infarction or ischemic stroke. Stroke. 2006 Jul;37 (7) :1686-90.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human UBE2L6 (NM_004223) AAV Particle
RC212405A1V 250 µL

Human UBE2L6 (NM_004223) AAV Particle

Sign In for Pricing
View Details
Recombinant Human Peroxiredoxin 1 Protein
NBC1-18543 0.1 mg

Recombinant Human Peroxiredoxin 1 Protein

Sign In for Pricing
View Details
KRT74 (NM_175053) Human Tagged ORF Clone
RC218329 10 µg

KRT74 (NM_175053) Human Tagged ORF Clone

Sign In for Pricing
View Details
Usp2 3'UTR Luciferase Stable Cell Line
TU222927 1.0 mL

Usp2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Lentiviral human SMURF1 sgRNA gene knockout kit - Lentiviral human SMURF1 sgRNA gene knockout kit (25)
GTR15383079 1 Vial

Lentiviral human SMURF1 sgRNA gene knockout kit - Lentiviral human SMURF1 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
RAMAC (NM_031452) Human Tagged ORF Clone
RC200815 10 µg

RAMAC (NM_031452) Human Tagged ORF Clone

Sign In for Pricing
View Details