Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AGER, Human (HEK293, His)

AGER Protein, Human (HEK293, His) is human recombinant AGER with a His tag at the C-terminus. AGER Protein, Human (HEK293, His) is expressed by mammalian expression system and the target gene encoding Ala23-Ala344 is expressed.

Product Specifications

Product Name Alternative

AGER Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ager-protein-human-hek293-his.html

Purity

98.0

Smiles

AQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALA

Molecular Formula

177 (Gene_ID) Q15109 (A23-A344) (Accession)

Molecular Weight

Approximately 48-60 kDa due to the glycosylation.

References & Citations

[1]Biros E, et al. Association between the Advanced Glycosylation End Product-Specific Receptor Gene and Cardiovascular Death in Older Men. PLoS One. 2015 Jul 30;10 (7) :e0134475.|[2]Zee RY, et al. Polymorphisms in the advanced glycosylation end product-specific receptor gene and risk of incident myocardial infarction or ischemic stroke. Stroke. 2006 Jul;37 (7) :1686-90.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Plant Protein Inhibitor of Activated Stat 1 (PIAS1) ELISA Kit
MBS9381334 Inquire

Plant Protein Inhibitor of Activated Stat 1 (PIAS1) ELISA Kit

Sign In for Pricing
View Details
HNF1A (4C3) Monoclonal Antibody
bsm-51187M 100 µL

HNF1A (4C3) Monoclonal Antibody

Sign In for Pricing
View Details
SNX8 sgRNA CRISPR Lentivector (Human) (Target 2)
K2254203 1.0 µg DNA

SNX8 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
C-Src Polyclonal Antibody
RA23847-01 50 µL

C-Src Polyclonal Antibody

Sign In for Pricing
View Details
C-Src Polyclonal Antibody
RA23847-02 100 µL

C-Src Polyclonal Antibody

Sign In for Pricing
View Details
PRG3 Protein Lysate (Rat) with C-HA Tag
37604036 100 µg

PRG3 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details