Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AGER, Human (HEK293, His)

AGER Protein, Human (HEK293, His) is human recombinant AGER with a His tag at the C-terminus. AGER Protein, Human (HEK293, His) is expressed by mammalian expression system and the target gene encoding Ala23-Ala344 is expressed.

Product Specifications

Product Name Alternative

AGER Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ager-protein-human-hek293-his.html

Purity

98.0

Smiles

AQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALA

Molecular Formula

177 (Gene_ID) Q15109 (A23-A344) (Accession)

Molecular Weight

Approximately 48-60 kDa due to the glycosylation.

References & Citations

[1]Biros E, et al. Association between the Advanced Glycosylation End Product-Specific Receptor Gene and Cardiovascular Death in Older Men. PLoS One. 2015 Jul 30;10 (7) :e0134475.|[2]Zee RY, et al. Polymorphisms in the advanced glycosylation end product-specific receptor gene and risk of incident myocardial infarction or ischemic stroke. Stroke. 2006 Jul;37 (7) :1686-90.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAR1, ID (GAR1, NOLA1, H/ACA ribonucleoprotein complex subunit 1, Nucleolar protein family A member 1, snoRNP protein GAR1) (APC)
MBS6301248-01 0.2 mL

GAR1, ID (GAR1, NOLA1, H/ACA ribonucleoprotein complex subunit 1, Nucleolar protein family A member 1, snoRNP protein GAR1) (APC)

Sign In for Pricing
View Details
GAR1, ID (GAR1, NOLA1, H/ACA ribonucleoprotein complex subunit 1, Nucleolar protein family A member 1, snoRNP protein GAR1) (APC)
MBS6301248-02 5x 0.2 mL

GAR1, ID (GAR1, NOLA1, H/ACA ribonucleoprotein complex subunit 1, Nucleolar protein family A member 1, snoRNP protein GAR1) (APC)

Sign In for Pricing
View Details
PLV3-CMV-DYRK1B-3xFLAG-mCherry-Puro Plasmid
PVT65763 2 µg

PLV3-CMV-DYRK1B-3xFLAG-mCherry-Puro Plasmid

Sign In for Pricing
View Details
ZNF573 (NM_152360) Human Tagged Lenti ORF Clone
RC209422L4 10 µg

ZNF573 (NM_152360) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
LRRC36, NT (LRRC36, RORBP70, Leucine-rich repeat-containing protein 36, ROR gamma-binding protein 70) (APC) discontinued
037952-APC 200 µL

LRRC36, NT (LRRC36, RORBP70, Leucine-rich repeat-containing protein 36, ROR gamma-binding protein 70) (APC) discontinued

Sign In for Pricing
View Details
TOMM5 Rabbit pAb
MBS9146032-01 0.02 mL

TOMM5 Rabbit pAb

Sign In for Pricing
View Details