Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AGER, Human (HEK293, His)

AGER Protein, Human (HEK293, His) is human recombinant AGER with a His tag at the C-terminus. AGER Protein, Human (HEK293, His) is expressed by mammalian expression system and the target gene encoding Ala23-Ala344 is expressed.

Product Specifications

Product Name Alternative

AGER Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ager-protein-human-hek293-his.html

Purity

98.0

Smiles

AQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALA

Molecular Formula

177 (Gene_ID) Q15109 (A23-A344) (Accession)

Molecular Weight

Approximately 48-60 kDa due to the glycosylation.

References & Citations

[1]Biros E, et al. Association between the Advanced Glycosylation End Product-Specific Receptor Gene and Cardiovascular Death in Older Men. PLoS One. 2015 Jul 30;10 (7) :e0134475.|[2]Zee RY, et al. Polymorphisms in the advanced glycosylation end product-specific receptor gene and risk of incident myocardial infarction or ischemic stroke. Stroke. 2006 Jul;37 (7) :1686-90.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vom1r1-set siRNA/shRNA/RNAi Lentivector (Rat)
49986096 4x 500 ng

Vom1r1-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Human IL-4
MBS691496-01 0.002 mg

Human IL-4

Sign In for Pricing
View Details
Human IL-4
MBS691496-02 5x 0.002 mg

Human IL-4

Sign In for Pricing
View Details
Mouse HP (Haptoglobin) ELISA Kit
EKE63291 96 Tests

Mouse HP (Haptoglobin) ELISA Kit

Sign In for Pricing
View Details
RGD1311249 siRNA Oligos set (Rat)
39130176 3x 5 nmol

RGD1311249 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Recombinant Human ORM1 Protein, Untagged, Human-10ug
QP12931-10ug 10ug

Recombinant Human ORM1 Protein, Untagged, Human-10ug

Sign In for Pricing
View Details