Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AGER, Human (HEK293, His)

AGER Protein, Human (HEK293, His) is human recombinant AGER with a His tag at the C-terminus. AGER Protein, Human (HEK293, His) is expressed by mammalian expression system and the target gene encoding Ala23-Ala344 is expressed.

Product Specifications

Product Name Alternative

AGER Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ager-protein-human-hek293-his.html

Purity

98.0

Smiles

AQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALA

Molecular Formula

177 (Gene_ID) Q15109 (A23-A344) (Accession)

Molecular Weight

Approximately 48-60 kDa due to the glycosylation.

References & Citations

[1]Biros E, et al. Association between the Advanced Glycosylation End Product-Specific Receptor Gene and Cardiovascular Death in Older Men. PLoS One. 2015 Jul 30;10 (7) :e0134475.|[2]Zee RY, et al. Polymorphisms in the advanced glycosylation end product-specific receptor gene and risk of incident myocardial infarction or ischemic stroke. Stroke. 2006 Jul;37 (7) :1686-90.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 Antibody (RPE)
GWB-5CE899 100 Tests

CD31 Antibody (RPE)

Sign In for Pricing
View Details
Anti-Hu CD154 FITC
MBS1800093-01 100 Tests

Anti-Hu CD154 FITC

Sign In for Pricing
View Details
Anti-Hu CD154 FITC
MBS1800093-02 5x 100 Tests

Anti-Hu CD154 FITC

Sign In for Pricing
View Details
Lentiviral mouse Bcor shRNA (UAS) - Lentiviral mouse Bcor shRNA (UAS, iRFP) (25)
GTR15302525 1 Vial

Lentiviral mouse Bcor shRNA (UAS) - Lentiviral mouse Bcor shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
pMD2.G-Kan Plasmid
PVT30401 2 µg

pMD2.G-Kan Plasmid

Sign In for Pricing
View Details
Gba2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3574105 3x 1.0 µg

Gba2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details