Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AGER, Human (HEK293, His)

AGER Protein, Human (HEK293, His) is human recombinant AGER with a His tag at the C-terminus. AGER Protein, Human (HEK293, His) is expressed by mammalian expression system and the target gene encoding Ala23-Ala344 is expressed.

Product Specifications

Product Name Alternative

AGER Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ager-protein-human-hek293-his.html

Purity

98.0

Smiles

AQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALA

Molecular Formula

177 (Gene_ID) Q15109 (A23-A344) (Accession)

Molecular Weight

Approximately 48-60 kDa due to the glycosylation.

References & Citations

[1]Biros E, et al. Association between the Advanced Glycosylation End Product-Specific Receptor Gene and Cardiovascular Death in Older Men. PLoS One. 2015 Jul 30;10 (7) :e0134475.|[2]Zee RY, et al. Polymorphisms in the advanced glycosylation end product-specific receptor gene and risk of incident myocardial infarction or ischemic stroke. Stroke. 2006 Jul;37 (7) :1686-90.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Peptidyl-prolyl cis/trans Isomerase (Pin1) AssayLite™ Antibody (RPE Conjugate)
11811-05051 5x 30 µg

Human Peptidyl-prolyl cis/trans Isomerase (Pin1) AssayLite™ Antibody (RPE Conjugate)

Sign In for Pricing
View Details
Pnck (NM_012040) Mouse Tagged ORF Clone Lentiviral Particle
MR205152L3V 200 µL

Pnck (NM_012040) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Lentiviral mouse Med29 shRNA (UAS) - Lentiviral mouse Med29 shRNA (UAS) plasmid
GTR15115063 1 Vial

Lentiviral mouse Med29 shRNA (UAS) - Lentiviral mouse Med29 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Tpo 3'UTR Lenti-reporter-Luc Vector
47381086 1.0 µg

Tpo 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Cldn34b4 (NM_001033799) Mouse Tagged ORF Clone
MR213048 10 µg

Cldn34b4 (NM_001033799) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
TMEM192 Antibody, mAb, Rabbit
A04090-50 50 µL

TMEM192 Antibody, mAb, Rabbit

Sign In for Pricing
View Details