Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AGER, Human (HEK293, His)

AGER Protein, Human (HEK293, His) is human recombinant AGER with a His tag at the C-terminus. AGER Protein, Human (HEK293, His) is expressed by mammalian expression system and the target gene encoding Ala23-Ala344 is expressed.

Product Specifications

Product Name Alternative

AGER Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ager-protein-human-hek293-his.html

Purity

98.0

Smiles

AQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALA

Molecular Formula

177 (Gene_ID) Q15109 (A23-A344) (Accession)

Molecular Weight

Approximately 48-60 kDa due to the glycosylation.

References & Citations

[1]Biros E, et al. Association between the Advanced Glycosylation End Product-Specific Receptor Gene and Cardiovascular Death in Older Men. PLoS One. 2015 Jul 30;10 (7) :e0134475.|[2]Zee RY, et al. Polymorphisms in the advanced glycosylation end product-specific receptor gene and risk of incident myocardial infarction or ischemic stroke. Stroke. 2006 Jul;37 (7) :1686-90.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal PFDN5 Antibody [Alexa Fluor 647]
NBP2-22337AF647 0.1 mL

Rabbit Polyclonal PFDN5 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
Docking Protein 2 (DOK2) Antibody
abx232501 100 µg

Docking Protein 2 (DOK2) Antibody

Sign In for Pricing
View Details
Zfp131 (NM_001100698) Rat Tagged ORF Clone Lentiviral Particle
RR202052L4V 200 µL

Zfp131 (NM_001100698) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
N6AMT1, NT (N6AMT1, C21orf127, HEMK2, HemK methyltransferase family member 2, M.HsaHemK2P, N (6) -adenine-specific DNA methyltransferase 1) (MaxLight 490) discontinued
038774-ML490 100 µL

N6AMT1, NT (N6AMT1, C21orf127, HEMK2, HemK methyltransferase family member 2, M.HsaHemK2P, N (6) -adenine-specific DNA methyltransferase 1) (MaxLight 490) discontinued

Sign In for Pricing
View Details
CXCL14 Human Pre-designed siRNA Set A
HY-RS03388 1 Set

CXCL14 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
FOXP1 Monoclonal Antibody
BT-MCA2406-01 50 µL

FOXP1 Monoclonal Antibody

Sign In for Pricing
View Details