AGER, Human (HEK293, His)
AGER Protein, Human (HEK293, His) is human recombinant AGER with a His tag at the C-terminus. AGER Protein, Human (HEK293, His) is expressed by mammalian expression system and the target gene encoding Ala23-Ala344 is expressed.
Product Specifications
Product Name Alternative
AGER Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ager-protein-human-hek293-his.html
Purity
98.0
Smiles
AQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALA
Molecular Formula
177 (Gene_ID) Q15109 (A23-A344) (Accession)
Molecular Weight
Approximately 48-60 kDa due to the glycosylation.
References & Citations
[1]Biros E, et al. Association between the Advanced Glycosylation End Product-Specific Receptor Gene and Cardiovascular Death in Older Men. PLoS One. 2015 Jul 30;10 (7) :e0134475.|[2]Zee RY, et al. Polymorphisms in the advanced glycosylation end product-specific receptor gene and risk of incident myocardial infarction or ischemic stroke. Stroke. 2006 Jul;37 (7) :1686-90.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
K0199-16D-PE 200 µL
KRT13, NT (Keratin, Type I Cytoskeletal 13, Cytokeratin-13, CK-13, Keratin-13, K13) (PE) discontinued
Sign In for Pricing
View Details MBS2048480-01 0.1 mL
APC/CY7-Linked Polyclonal Antibody to Von Willebrand Factor A Domain Containing Protein 1 (vWA1)
Sign In for Pricing
View Details 
MBS2048480-02 0.2 mL
APC/CY7-Linked Polyclonal Antibody to Von Willebrand Factor A Domain Containing Protein 1 (vWA1)
Sign In for Pricing
View Details 
MBS2048480-03 0.5 mL
APC/CY7-Linked Polyclonal Antibody to Von Willebrand Factor A Domain Containing Protein 1 (vWA1)
Sign In for Pricing
View Details MBS2048480-04 1 mL
APC/CY7-Linked Polyclonal Antibody to Von Willebrand Factor A Domain Containing Protein 1 (vWA1)
Sign In for Pricing
View Details