Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AGER, Human (HEK293, His)

AGER Protein, Human (HEK293, His) is human recombinant AGER with a His tag at the C-terminus. AGER Protein, Human (HEK293, His) is expressed by mammalian expression system and the target gene encoding Ala23-Ala344 is expressed.

Product Specifications

Product Name Alternative

AGER Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ager-protein-human-hek293-his.html

Purity

98.0

Smiles

AQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALA

Molecular Formula

177 (Gene_ID) Q15109 (A23-A344) (Accession)

Molecular Weight

Approximately 48-60 kDa due to the glycosylation.

References & Citations

[1]Biros E, et al. Association between the Advanced Glycosylation End Product-Specific Receptor Gene and Cardiovascular Death in Older Men. PLoS One. 2015 Jul 30;10 (7) :e0134475.|[2]Zee RY, et al. Polymorphisms in the advanced glycosylation end product-specific receptor gene and risk of incident myocardial infarction or ischemic stroke. Stroke. 2006 Jul;37 (7) :1686-90.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Ndufb4 qPCR Primer Pair
QM35862S 200 Tests

Mouse Ndufb4 qPCR Primer Pair

Sign In for Pricing
View Details
TRAIP Overexpression Lysate (Native) - (Dry Ice)
NBL1-17250 0.1 mg

TRAIP Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
RIPK3 3'UTR GFP Stable Cell Line
TU069938 1.0 mL

RIPK3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
ALDH1B1 (Aldehyde Dehydrogenase X, Mitochondrial, Aldehyde Dehydrogenase Family 1 Member B1, Aldehyde Dehydrogenase 5, ALDH5, ALDHX)
123197 100 µg

ALDH1B1 (Aldehyde Dehydrogenase X, Mitochondrial, Aldehyde Dehydrogenase Family 1 Member B1, Aldehyde Dehydrogenase 5, ALDH5, ALDHX)

Sign In for Pricing
View Details
Porcine AVPR1A (Arginine Vasopressin Receptor 1A) ELISA Kit
MBS2505785-01 24 Tests

Porcine AVPR1A (Arginine Vasopressin Receptor 1A) ELISA Kit

Sign In for Pricing
View Details
Porcine AVPR1A (Arginine Vasopressin Receptor 1A) ELISA Kit
MBS2505785-02 48 Tests

Porcine AVPR1A (Arginine Vasopressin Receptor 1A) ELISA Kit

Sign In for Pricing
View Details