Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AGER, Human (HEK293, His)

AGER Protein, Human (HEK293, His) is human recombinant AGER with a His tag at the C-terminus. AGER Protein, Human (HEK293, His) is expressed by mammalian expression system and the target gene encoding Ala23-Ala344 is expressed.

Product Specifications

Product Name Alternative

AGER Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ager-protein-human-hek293-his.html

Purity

98.0

Smiles

AQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALA

Molecular Formula

177 (Gene_ID) Q15109 (A23-A344) (Accession)

Molecular Weight

Approximately 48-60 kDa due to the glycosylation.

References & Citations

[1]Biros E, et al. Association between the Advanced Glycosylation End Product-Specific Receptor Gene and Cardiovascular Death in Older Men. PLoS One. 2015 Jul 30;10 (7) :e0134475.|[2]Zee RY, et al. Polymorphisms in the advanced glycosylation end product-specific receptor gene and risk of incident myocardial infarction or ischemic stroke. Stroke. 2006 Jul;37 (7) :1686-90.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYR61 Knockout Hela Polyclonal Cells
ARG8415 1 Million

CYR61 Knockout Hela Polyclonal Cells

Sign In for Pricing
View Details
MAU-2 shRNA Plasmid (m)
sc-140528-SH 20 µg

MAU-2 shRNA Plasmid (m)

Sign In for Pricing
View Details
Mouse Monoclonal SR-AI/MSR Antibody (351615) [Allophycocyanin/Cy7]
FAB2708APCCY7 0.1 mL

Mouse Monoclonal SR-AI/MSR Antibody (351615) [Allophycocyanin/Cy7]

Sign In for Pricing
View Details
UGT2A1 Peptide - middle region
MBS3245358-01 0.1 mg

UGT2A1 Peptide - middle region

Sign In for Pricing
View Details
UGT2A1 Peptide - middle region
MBS3245358-02 5x 0.1 mg

UGT2A1 Peptide - middle region

Sign In for Pricing
View Details
ZAK (AZK, MLK7, MLT, MLTK, MRK, Mlklak) (PE)
MBS6161506-01 0.1 mL

ZAK (AZK, MLK7, MLT, MLTK, MRK, Mlklak) (PE)

Sign In for Pricing
View Details