Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AGER, Human (HEK293, His)

AGER Protein, Human (HEK293, His) is human recombinant AGER with a His tag at the C-terminus. AGER Protein, Human (HEK293, His) is expressed by mammalian expression system and the target gene encoding Ala23-Ala344 is expressed.

Product Specifications

Product Name Alternative

AGER Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ager-protein-human-hek293-his.html

Purity

98.0

Smiles

AQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALA

Molecular Formula

177 (Gene_ID) Q15109 (A23-A344) (Accession)

Molecular Weight

Approximately 48-60 kDa due to the glycosylation.

References & Citations

[1]Biros E, et al. Association between the Advanced Glycosylation End Product-Specific Receptor Gene and Cardiovascular Death in Older Men. PLoS One. 2015 Jul 30;10 (7) :e0134475.|[2]Zee RY, et al. Polymorphisms in the advanced glycosylation end product-specific receptor gene and risk of incident myocardial infarction or ischemic stroke. Stroke. 2006 Jul;37 (7) :1686-90.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sytl2 (NM_001289586) Mouse Untagged Clone
MC227366 10 µg

Sytl2 (NM_001289586) Mouse Untagged Clone

Sign In for Pricing
View Details
CCNG2, GST-Tag, Recombinant (Cyclin-G2) discontinued
500650 200 µg

CCNG2, GST-Tag, Recombinant (Cyclin-G2) discontinued

Sign In for Pricing
View Details
Thiourea 98% Extrapure
02690 00500 500 g

Thiourea 98% Extrapure

Sign In for Pricing
View Details
SPP2 Protein Vector (Rat) (pPM-C-HA)
PV307864 500 ng

SPP2 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
FAM190B (CCSER2) (NM_001284241) Human Untagged Clone
SC336818 10 µg

FAM190B (CCSER2) (NM_001284241) Human Untagged Clone

Sign In for Pricing
View Details
TAPA1/CD81 Antibody
MBS9435875-01 0.05 mL

TAPA1/CD81 Antibody

Sign In for Pricing
View Details