Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AGER, Human (HEK293, His)

AGER Protein, Human (HEK293, His) is human recombinant AGER with a His tag at the C-terminus. AGER Protein, Human (HEK293, His) is expressed by mammalian expression system and the target gene encoding Ala23-Ala344 is expressed.

Product Specifications

Product Name Alternative

AGER Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ager-protein-human-hek293-his.html

Purity

98.0

Smiles

AQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALA

Molecular Formula

177 (Gene_ID) Q15109 (A23-A344) (Accession)

Molecular Weight

Approximately 48-60 kDa due to the glycosylation.

References & Citations

[1]Biros E, et al. Association between the Advanced Glycosylation End Product-Specific Receptor Gene and Cardiovascular Death in Older Men. PLoS One. 2015 Jul 30;10 (7) :e0134475.|[2]Zee RY, et al. Polymorphisms in the advanced glycosylation end product-specific receptor gene and risk of incident myocardial infarction or ischemic stroke. Stroke. 2006 Jul;37 (7) :1686-90.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRT35 Protein Vector (Human) (pPB-C-His)
PV089754 500 ng

KRT35 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Customized Organic Acids Panel-2 in UrineTune Mix
ZV-3066-02TM-20 3 mL

Customized Organic Acids Panel-2 in UrineTune Mix

Sign In for Pricing
View Details
D13S319 gene deletion probe
FP-200 1 Vial 100 μL (10-20 T)

D13S319 gene deletion probe

Sign In for Pricing
View Details
Rabbit Polyclonal JMJD2D Antibody [Biotin]
NBP1-03357B 0.1 mL

Rabbit Polyclonal JMJD2D Antibody [Biotin]

Sign In for Pricing
View Details
Srrm4 Mouse Gene Knockout Kit (CRISPR)
KN516738 1 Kit

Srrm4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rabbit Polyclonal PUS1 Antibody
NBP1-32902 100 µL

Rabbit Polyclonal PUS1 Antibody

Sign In for Pricing
View Details