Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPY Peptide - middle region

NPY Peptide - middle region

Product Specifications

Product Name Alternative

PYY4

UniProt

P01303

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NPY Rabbit Polyclonal Antibody (orb333712) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000896

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDE6 beta (PDE6B) (NM_000283) Human Tagged Lenti ORF Clone
RC200445L2 10 µg

PDE6 beta (PDE6B) (NM_000283) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
MAP7D1 Polyclonal Antibody
RD88362A-01 60 μL

MAP7D1 Polyclonal Antibody

Sign In for Pricing
View Details
MAP7D1 Polyclonal Antibody
RD88362A-02 120 μL

MAP7D1 Polyclonal Antibody

Sign In for Pricing
View Details
MAP7D1 Polyclonal Antibody
RD88362A-03 200 µL

MAP7D1 Polyclonal Antibody

Sign In for Pricing
View Details
Guinea pig Gelson ELISA Kit
NSL0774Gp 96 Tests

Guinea pig Gelson ELISA Kit

Sign In for Pricing
View Details
RNase R (GMP grade, 20 U/μL)
14615ES25 500 U

RNase R (GMP grade, 20 U/μL)

Sign In for Pricing
View Details