Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPY Peptide - middle region

NPY Peptide - middle region

Product Specifications

Product Name Alternative

PYY4

UniProt

P01303

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NPY Rabbit Polyclonal Antibody (orb333712) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000896

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APLN hFc Chimera, Mouse
Z06005-100 100 µg

APLN hFc Chimera, Mouse

Sign In for Pricing
View Details
NIPP1 (A-11) : m-IgGκ BP-HRP Bundle
sc-524170 1 Kit

NIPP1 (A-11) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details
COBL Rabbit Polyclonal Antibody (PE-Cy5.5)
orb970517 100 µL

COBL Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details
KRTAP19-7 sgRNA CRISPR Lentivector set (Human)
K1188601 3x 1.0 µg

KRTAP19-7 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
TANK Antibody
MBS7049236-01 0.05 mg

TANK Antibody

Sign In for Pricing
View Details
TANK Antibody
MBS7049236-02 0.1 mg

TANK Antibody

Sign In for Pricing
View Details