Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MST1 Peptide - N-terminal region

MST1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

D3F15S2, DNF15S2, HGFL, MSP, NF15S2

UniProt

P26927

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MST1 Rabbit Polyclonal Antibody (orb579555) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_066278

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TQCLGVPGQRSPLNDFQVLRGTELQHLLHAVVPGPWQEDVADAEECAGRC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Abcb7 Mouse Gene Knockout Kit (CRISPR)
KN500618 1 Kit

Abcb7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
WNT1 Mouse Monoclonal Antibody [Clone ID: 10C8]
AM06361SU-N 100 µL

WNT1 Mouse Monoclonal Antibody [Clone ID: 10C8]

Sign In for Pricing
View Details
1,2,3,4,5,6,7-Heptachloronaphthalene (>90%)
TRC-H265210-1MG 1 mg

1,2,3,4,5,6,7-Heptachloronaphthalene (>90%)

Sign In for Pricing
View Details
LRRC2 (NM_024512) Human Recombinant Protein
TP316196M 100 µg

LRRC2 (NM_024512) Human Recombinant Protein

Sign In for Pricing
View Details
ECT2L (C-term) Rabbit Polyclonal Antibody
AP51361PU-N 400 µL

ECT2L (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
C14orf130 (UBR7) Human Gene Knockout Kit (CRISPR)
KN415315 1 Kit

C14orf130 (UBR7) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details