MST1 Peptide - N-terminal region
MST1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
D3F15S2, DNF15S2, HGFL, MSP, NF15S2
UniProt
P26927
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MST1 Rabbit Polyclonal Antibody (orb579555) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_066278
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TQCLGVPGQRSPLNDFQVLRGTELQHLLHAVVPGPWQEDVADAEECAGRC
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![PE/Cyanine5 Anti-Human CD39 Antibody[A1]](https://cdn.genprice.uk/products/763/68dd14ad061270361e7d3233/imageurl/e-ab-f1165g.webp)
E-AB-F1165G-03 2x 100 Tests
PE/Cyanine5 Anti-Human CD39 Antibody[A1]
Sign In for Pricing
View Details 
TRC-B285920-25MG 25 mg
(S)-3-Benzyloxycarbonyl-4-(3-oxobutyl)-5-oxazilidinone
Sign In for Pricing
View Details 
AP20986PU-N 100 µg
LIM Kinase 1 (LIMK1) (+LIMK2) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details