Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCDHGB5 Peptide - middle region

PCDHGB5 Peptide - middle region

Product Specifications

Product Name Alternative

PCDH-GAMMA-B5

UniProt

Q9Y5G0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PCDHGB5 Rabbit Polyclonal Antibody (orb580711) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115270

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PLSGTTELRIQVTDANDNPPVFNRDVYRVSLRENVPPGTTVLQVSATDQD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (rNX2/1523), CF640R conjugate, 0.1mg/mL
BNC402309-500 1x 500 µL

NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (rNX2/1523), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
4-Phenylphenol
TRC-P336135-1G 1 g

4-Phenylphenol

Sign In for Pricing
View Details
Chlorfenvinphos (E/Z mixture)
TRC-C324365-50MG 50 mg

Chlorfenvinphos (E/Z mixture)

Sign In for Pricing
View Details
Recombinant Human ER alpha protein (His tag)
PDEH100893-01 20 µg

Recombinant Human ER alpha protein (His tag)

Sign In for Pricing
View Details
Recombinant Human ER alpha protein (His tag)
PDEH100893-02 100 µg

Recombinant Human ER alpha protein (His tag)

Sign In for Pricing
View Details
Recombinant Human ER alpha protein (His tag)
PDEH100893-03 500 µg

Recombinant Human ER alpha protein (His tag)

Sign In for Pricing
View Details