Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCDHGB5 Peptide - middle region

PCDHGB5 Peptide - middle region

Product Specifications

Product Name Alternative

PCDH-GAMMA-B5

UniProt

Q9Y5G0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PCDHGB5 Rabbit Polyclonal Antibody (orb580711) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115270

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PLSGTTELRIQVTDANDNPPVFNRDVYRVSLRENVPPGTTVLQVSATDQD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KCNT1 activation kit by CRISPRa
GA111608 1 Kit

Human KCNT1 activation kit by CRISPRa

Sign In for Pricing
View Details
KCNE3 (NM_005472) Human Over-expression Lysate
LY401689 100 µg

KCNE3 (NM_005472) Human Over-expression Lysate

Sign In for Pricing
View Details
PAI1 (SERPINE1) Rabbit Monoclonal Antibody [Clone ID: R07-2C3]
TA385228 100 µL

PAI1 (SERPINE1) Rabbit Monoclonal Antibody [Clone ID: R07-2C3]

Sign In for Pricing
View Details
Human RPL10L activation kit by CRISPRa
GA115409 1 Kit

Human RPL10L activation kit by CRISPRa

Sign In for Pricing
View Details
CD9 Rabbit Polyclonal Antibody
ER80402 100 µL

CD9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Colloidal Gold Labeled HBsAg Recombinant Protein, 1mL 5nm
GM-601-5 1 mL

Colloidal Gold Labeled HBsAg Recombinant Protein, 1mL 5nm

Sign In for Pricing
View Details