Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCDHA6 Peptide - N-terminal region

PCDHA6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CNR2, CNRN2, CNRS2, CRNR2, PCDH-ALPHA6

UniProt

Q9UN73

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PCDHA6 Rabbit Polyclonal Antibody (orb580947) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_114037

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LAAWKVGSGQLHYSVPEEAKHGTFVGRIAQDLGLELAELVPRLFRMASKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKM2 (PKM) Human Gene Knockout Kit (CRISPR)
KN201855LP 1 Kit

PKM2 (PKM) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LIN28B (C-term) Rabbit Polyclonal Antibody
AP11495PU-N 400 µL

LIN28B (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Selenoprotein P1, Plasma (SEPP1) ELISA Kit
RD-SEPP1-Hu-01 96 Tests

Human Selenoprotein P1, Plasma (SEPP1) ELISA Kit

Sign In for Pricing
View Details
Human Selenoprotein P1, Plasma (SEPP1) ELISA Kit
RD-SEPP1-Hu-02 48 Tests

Human Selenoprotein P1, Plasma (SEPP1) ELISA Kit

Sign In for Pricing
View Details
Human Nuclear Factor Kappa B (NFkB) ELISA Kit
RDR-NFkB-Hu-01 96 Tests

Human Nuclear Factor Kappa B (NFkB) ELISA Kit

Sign In for Pricing
View Details
Human Nuclear Factor Kappa B (NFkB) ELISA Kit
RDR-NFkB-Hu-02 48 Tests

Human Nuclear Factor Kappa B (NFkB) ELISA Kit

Sign In for Pricing
View Details