Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCDHA3 Peptide - middle region

PCDHA3 Peptide - middle region

Product Specifications

Product Name Alternative

PCDH-ALPHA3

UniProt

Q9Y5H8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PCDHA3 Rabbit Polyclonal Antibody (orb580949) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061729

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ATATVLVSLVESGQAPKASSQASAGATGPEAALVDVNVYLIVAICAVSSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CCDC88C siRNA
abx910718-01 15 nmol

Human CCDC88C siRNA

Sign In for Pricing
View Details
Human CCDC88C siRNA
abx910718-02 30 nmol

Human CCDC88C siRNA

Sign In for Pricing
View Details
HPCAL4 Mouse Monoclonal Antibody [Clone ID: OTI3C3]
CF808680 100 µg

HPCAL4 Mouse Monoclonal Antibody [Clone ID: OTI3C3]

Sign In for Pricing
View Details
VPS13C Human qPCR Primer Pair (NM_017684)
HP228851 200 Reactions

VPS13C Human qPCR Primer Pair (NM_017684)

Sign In for Pricing
View Details
Recombinant Haemophilus Influenzae tdk Protein (aa 1-193) (strain 86-028NP)
VAng-Lsx03893-1mgEcoli 1 mg (E. coli)

Recombinant Haemophilus Influenzae tdk Protein (aa 1-193) (strain 86-028NP)

Sign In for Pricing
View Details
LMOD1 (NM_012134) Human Tagged ORF Clone
RC209941 10 µg

LMOD1 (NM_012134) Human Tagged ORF Clone

Sign In for Pricing
View Details