Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCDHA3 Peptide - middle region

PCDHA3 Peptide - middle region

Product Specifications

Product Name Alternative

PCDH-ALPHA3

UniProt

Q9Y5H8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PCDHA3 Rabbit Polyclonal Antibody (orb580949) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061729

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ATATVLVSLVESGQAPKASSQASAGATGPEAALVDVNVYLIVAICAVSSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZKSCAN3 (NM_024493) Human Tagged Lenti ORF Clone
RC202971L1 10 µg

ZKSCAN3 (NM_024493) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
KCND2 Protein Lysate
OCOA11546-20UG 20 µg

KCND2 Protein Lysate

Sign In for Pricing
View Details
Lentiviral mouse Anp32a shRNA (UAS) - Lentiviral mouse Anp32a shRNA (UAS) (25)
GTR15252281 1 Vial

Lentiviral mouse Anp32a shRNA (UAS) - Lentiviral mouse Anp32a shRNA (UAS) (25)

Sign In for Pricing
View Details
Feline Leukemia Virus, p15E (FeLV) (MaxLight 750)
MBS6256999-01 0.1 mL

Feline Leukemia Virus, p15E (FeLV) (MaxLight 750)

Sign In for Pricing
View Details
Feline Leukemia Virus, p15E (FeLV) (MaxLight 750)
MBS6256999-02 5x 0.1 mL

Feline Leukemia Virus, p15E (FeLV) (MaxLight 750)

Sign In for Pricing
View Details
Rat Apolipoprotein C1 (APOC1) ELISA Kit
DLR-APOC1-Ra-96T 96 Tests

Rat Apolipoprotein C1 (APOC1) ELISA Kit

Sign In for Pricing
View Details