Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT85 Peptide - C-terminal region

KRT85 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HB5, Hb-5, KRTHB5, hHb5

UniProt

P78386

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KRT85 Rabbit Polyclonal Antibody (orb586492) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002274

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DVASRSRAEAESWYRSKCEEMKATVIRHGETLRRTKEEINELNRMIQRLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Rab5/RAB5A Antibody Picoband® (monoclonal, 3E9)-iFluor647 Conjugate
M01891-1-iFluor647 100 µg

Anti-Rab5/RAB5A Antibody Picoband® (monoclonal, 3E9)-iFluor647 Conjugate

Sign In for Pricing
View Details
XAGE3 (NM_130776) Human Recombinant Protein
PROTQ8WTP9 20 µg

XAGE3 (NM_130776) Human Recombinant Protein

Sign In for Pricing
View Details
Mouse Anti-Influenza A Virus H13 Subtype Haemagglutinin (HA) Monoclonal Antibody
VD7N209 1 Each

Mouse Anti-Influenza A Virus H13 Subtype Haemagglutinin (HA) Monoclonal Antibody

Sign In for Pricing
View Details
OSTF1, Recombinant, Human, His-Tag (Osteoclast Stimulating Factor 1, SH3P2, OSF) discontinued
301260 100 µg

OSTF1, Recombinant, Human, His-Tag (Osteoclast Stimulating Factor 1, SH3P2, OSF) discontinued

Sign In for Pricing
View Details
MSX1 Over-expression Lysate Product
GWB-2B68F7 0.1 mg

MSX1 Over-expression Lysate Product

Sign In for Pricing
View Details
(3R) -3- (Propan-2-yl) morpholine
OR308181-01 100 mg

(3R) -3- (Propan-2-yl) morpholine

Sign In for Pricing
View Details