Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT85 Peptide - C-terminal region

KRT85 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HB5, Hb-5, KRTHB5, hHb5

UniProt

P78386

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KRT85 Rabbit Polyclonal Antibody (orb586492) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002274

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DVASRSRAEAESWYRSKCEEMKATVIRHGETLRRTKEEINELNRMIQRLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Lambda Light Chain Antibody (1-155-2) [Janelia Fluor 646]
NBP1-79124JF646 0.1 mL

Mouse Monoclonal Lambda Light Chain Antibody (1-155-2) [Janelia Fluor 646]

Sign In for Pricing
View Details
Mouse Monoclonal FAHD2A Antibody (OTI6D9) [HRP]
NBP2-71886H 0.1 mL

Mouse Monoclonal FAHD2A Antibody (OTI6D9) [HRP]

Sign In for Pricing
View Details
anti-PSME1
YF-PA14150 50 ul

anti-PSME1

Sign In for Pricing
View Details
CSTF1 (Cleavage Stimulation Factor Subunit 1) discontinued
218075-01 50 µL

CSTF1 (Cleavage Stimulation Factor Subunit 1) discontinued

Sign In for Pricing
View Details
CSTF1 (Cleavage Stimulation Factor Subunit 1) discontinued
218075-02 100 µL

CSTF1 (Cleavage Stimulation Factor Subunit 1) discontinued

Sign In for Pricing
View Details
Mouse Anti-CCND2 Recombinant Antibody (ZG-0447F)
ZG-0447F Each

Mouse Anti-CCND2 Recombinant Antibody (ZG-0447F)

Sign In for Pricing
View Details