Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMAP2 Peptide - N-terminal region

SMAP2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

RP1-228H13.3, SMAP1L

UniProt

Q8WU79

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SMAP2 Rabbit Polyclonal Antibody (orb586517) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_073570

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LPETFRRPQIDPAVEGFIRDKYEKKKYMDRSLDINAFRKEKDDKWKRGSE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFNA14 Antibody
A25877-100UG 100 µg

IFNA14 Antibody

Sign In for Pricing
View Details
StuI Restriction Endonucleases
E2405-01 1000 U

StuI Restriction Endonucleases

Sign In for Pricing
View Details
PIP4K2A Protein Vector (Rat) (pPM-C-His)
PV294133 500 ng

PIP4K2A Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
N, N-Dimethylacetamide For Synthesis
104530 2.5 2.5 mL

N, N-Dimethylacetamide For Synthesis

Sign In for Pricing
View Details
Aldrin [CAS:309-00-2] 10 ug/ml in Methanol
P803670 10 mL

Aldrin [CAS:309-00-2] 10 ug/ml in Methanol

Sign In for Pricing
View Details
Bovine Tissue Inhibitors Of Metalloproteinase 1 (TIMP1) ELISA Kit
DLR-TIMP1-b-96T 96 Tests

Bovine Tissue Inhibitors Of Metalloproteinase 1 (TIMP1) ELISA Kit

Sign In for Pricing
View Details