Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMAP2 Peptide - N-terminal region

SMAP2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

RP1-228H13.3, SMAP1L

UniProt

Q8WU79

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SMAP2 Rabbit Polyclonal Antibody (orb586517) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_073570

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LPETFRRPQIDPAVEGFIRDKYEKKKYMDRSLDINAFRKEKDDKWKRGSE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(R) -BAY-747
orb3174201-01 10 mg

(R) -BAY-747

Sign In for Pricing
View Details
(R) -BAY-747
orb3174201-02 50 mg

(R) -BAY-747

Sign In for Pricing
View Details
Interleukin-9; IL-9 Protein (C-His, Mouse)
P516451 100 µg

Interleukin-9; IL-9 Protein (C-His, Mouse)

Sign In for Pricing
View Details
Human Pepsin (PP) ELISA Kit
EKN49687 96 Tests

Human Pepsin (PP) ELISA Kit

Sign In for Pricing
View Details
Rabbit anti-OX40/CD134 Recombinant Monoclonal Antibody [BLR042F]
MBS3906282-01 0.1 mg

Rabbit anti-OX40/CD134 Recombinant Monoclonal Antibody [BLR042F]

Sign In for Pricing
View Details
Rabbit anti-OX40/CD134 Recombinant Monoclonal Antibody [BLR042F]
MBS3906282-02 5x 0.1 mg

Rabbit anti-OX40/CD134 Recombinant Monoclonal Antibody [BLR042F]

Sign In for Pricing
View Details