Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR142 Peptide - N-terminal region

GPR142 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PGR2

UniProt

Q7Z601

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR142 Rabbit Polyclonal Antibody (orb331350) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_861455

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IMMLPMEQKIQWVPTSLQDITAVLGTEAYTEEDKSMVSHAQKSQHSCLSH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL18 (NM_001562) Human Over-expression Lysate
LC400599 20 µg

IL18 (NM_001562) Human Over-expression Lysate

Sign In for Pricing
View Details
Thyroglobulin (Thyroidal Cell Marker) (rTGB24), CF594 conjugate, 0.1mg/mL
BNC941967-500 1x 500 µL

Thyroglobulin (Thyroidal Cell Marker) (rTGB24), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACMSD Rabbit Polyclonal Antibody
TA373195 100 µL

ACMSD Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
4-(2,3-Epoxypropoxy-d5)carbazole
TRC-E589252-10MG 10 mg

4-(2,3-Epoxypropoxy-d5)carbazole

Sign In for Pricing
View Details
Integrin beta 4 (ITGB4) (NM_000213) Human Over-expression Lysate
LY424862 100 µg

Integrin beta 4 (ITGB4) (NM_000213) Human Over-expression Lysate

Sign In for Pricing
View Details
Crotonaldehyde Antibody: FITC
SMC-534D-FITC 100 µg

Crotonaldehyde Antibody: FITC

Sign In for Pricing
View Details