Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR142 Peptide - N-terminal region

GPR142 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PGR2

UniProt

Q7Z601

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR142 Rabbit Polyclonal Antibody (orb331350) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_861455

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IMMLPMEQKIQWVPTSLQDITAVLGTEAYTEEDKSMVSHAQKSQHSCLSH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Nitroso-di-n-butylamine
TRC-N525535-5G 5 g

N-Nitroso-di-n-butylamine

Sign In for Pricing
View Details
Human PKD1L1 activation kit by CRISPRa
GA116174 1 Kit

Human PKD1L1 activation kit by CRISPRa

Sign In for Pricing
View Details
ZNF35 Mouse Monoclonal Antibody [Clone ID: OTI3B5]
CF807123 100 µg

ZNF35 Mouse Monoclonal Antibody [Clone ID: OTI3B5]

Sign In for Pricing
View Details
Putative uncharacterized protein LOC388820 (LOC388820) Human Gene Knockout Kit (CRISPR)
KN418653 1 Kit

Putative uncharacterized protein LOC388820 (LOC388820) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MBD5 Antibody
KC-32651-01 50 μL

MBD5 Antibody

Sign In for Pricing
View Details
MBD5 Antibody
KC-32651-02 100 µL

MBD5 Antibody

Sign In for Pricing
View Details