CKMT1B Peptide - N-terminal region
CKMT1B Peptide - N-terminal region
Product Specifications
UniProt
P12532
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CKMT1B Rabbit Polyclonal Antibody (orb55723) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_005254554
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TVGMVAGDEETYEVFADLFDPVIQERHNGYDPRTMKHTTDLDASKIRSGY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E-EL-H1629-01 24 Tests
Human EGFR2(Epidermal Growth Factor Receptor 2) ELISA Kit
Sign In for Pricing
View Details E-EL-H1629-02 48 Tests
Human EGFR2(Epidermal Growth Factor Receptor 2) ELISA Kit
Sign In for Pricing
View Details