Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CKMT1B Peptide - N-terminal region

CKMT1B Peptide - N-terminal region

Product Specifications

UniProt

P12532

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CKMT1B Rabbit Polyclonal Antibody (orb55723) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005254554

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TVGMVAGDEETYEVFADLFDPVIQERHNGYDPRTMKHTTDLDASKIRSGY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E-Cadherin (CDH1) / CD324 (Intercellular Junction Marker) (rCDH1/1525), CF647 conjugate, 0.1mg/mL
BNC472067-500 1x 500 µL

E-Cadherin (CDH1) / CD324 (Intercellular Junction Marker) (rCDH1/1525), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TCN2 Rabbit Polyclonal Antibody
TA365831 100 µL

TCN2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Dibenzo[def,p]chrysene-d8 (Major)
TRC-D416947-10MG 10 mg

Dibenzo[def,p]chrysene-d8 (Major)

Sign In for Pricing
View Details
2,4-Diphenylthiazole-5-carboxylic Acid
TRC-B432888-50MG 50 mg

2,4-Diphenylthiazole-5-carboxylic Acid

Sign In for Pricing
View Details
ER81 (ETV1) Rabbit Polyclonal Antibody
AP20524PU-N 100 µg

ER81 (ETV1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse UCHL3/UCH-L3 Protein (His Tag)
PKSM040544 50 µg

Recombinant Mouse UCHL3/UCH-L3 Protein (His Tag)

Sign In for Pricing
View Details