Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DGLUCY Peptide - C-terminal region

DGLUCY Peptide - C-terminal region

Product Specifications

Product Name Alternative

C14orf159

UniProt

Q7Z3D6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DGLUCY Rabbit Polyclonal Antibody (orb587144) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AKKIPGISSTGVGDGGNELGMGKVKEAVRRHIRHGDVIACDVEADFAVIA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTTP Protein Lysate (Mouse) with C-HA Tag
31117035 100 µg

MTTP Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Pig APOB (Apolipoprotein B) ELISA Kit
MBS8806852-01 48 Strip Well

Pig APOB (Apolipoprotein B) ELISA Kit

Sign In for Pricing
View Details
Pig APOB (Apolipoprotein B) ELISA Kit
MBS8806852-02 96 Strip Well

Pig APOB (Apolipoprotein B) ELISA Kit

Sign In for Pricing
View Details
Pig APOB (Apolipoprotein B) ELISA Kit
MBS8806852-03 5x 96 Strip Well

Pig APOB (Apolipoprotein B) ELISA Kit

Sign In for Pricing
View Details
Pig APOB (Apolipoprotein B) ELISA Kit
MBS8806852-04 10x 96 Strip Well

Pig APOB (Apolipoprotein B) ELISA Kit

Sign In for Pricing
View Details
SAMHD1/MOP5 Recombinant Antibody, PE-Cy5 Conjugated
bsm-61737R-PE-Cy5-01 20 µL

SAMHD1/MOP5 Recombinant Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details