Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC107 Peptide - N-terminal region

CCDC107 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PSEC0222

UniProt

Q8WV48

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC107 Rabbit Polyclonal Antibody (orb587252) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_777583

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PPLKDQRERTRAGSLPLGALYTAAVAAFVLYKCLQGKDETAVLHEEASKQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal STARD10 Antibody [DyLight 405]
NBP2-78818V 0.1 mL

Rabbit Polyclonal STARD10 Antibody [DyLight 405]

Sign In for Pricing
View Details
Recombinant Human THEM4 Protein
E30P7796 20 µg

Recombinant Human THEM4 Protein

Sign In for Pricing
View Details
ZN547 rabbit pAb
UB-GEN-12033 100 µL

ZN547 rabbit pAb

Sign In for Pricing
View Details
GFP hsa-miR-654-3p AAV miRNA Vector
Amh1116300 500 ng

GFP hsa-miR-654-3p AAV miRNA Vector

Sign In for Pricing
View Details
ARF4P2 AAV siRNA Pooled Vector
12255161 1.0 µg

ARF4P2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Rat Ogdhl Pre-designed siRNA Set B
SI209746B 1 Each

Rat Ogdhl Pre-designed siRNA Set B

Sign In for Pricing
View Details