Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC107 Peptide - N-terminal region

CCDC107 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PSEC0222

UniProt

Q8WV48

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC107 Rabbit Polyclonal Antibody (orb587252) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_777583

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PPLKDQRERTRAGSLPLGALYTAAVAAFVLYKCLQGKDETAVLHEEASKQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR3A2 Antibody (C-term)
orb2996717-01 50 µL

OR3A2 Antibody (C-term)

Sign In for Pricing
View Details
OR3A2 Antibody (C-term)
orb2996717-02 100 µL

OR3A2 Antibody (C-term)

Sign In for Pricing
View Details
ORC6 Rabbit Polyclonal Antibody (Cy7)
orb1071508 100 µL

ORC6 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
mmu-miR-3069-3p miRNA Inhibitor
MBS8296099-01 10 nmol

mmu-miR-3069-3p miRNA Inhibitor

Sign In for Pricing
View Details
mmu-miR-3069-3p miRNA Inhibitor
MBS8296099-02 20 nmol

mmu-miR-3069-3p miRNA Inhibitor

Sign In for Pricing
View Details
mmu-miR-3069-3p miRNA Inhibitor
MBS8296099-03 5x 20 nmol

mmu-miR-3069-3p miRNA Inhibitor

Sign In for Pricing
View Details