Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TESPA1 Peptide - C-terminal region

TESPA1 Peptide - C-terminal region

Product Specifications

UniProt

A2RU30

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TESPA1 Rabbit Polyclonal Antibody (orb327011) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005269304

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLPIEDPQWSTDPAQIRRELCSLPATNTETHPAKDETFWKRKSRARKSLF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BMF Mouse Monoclonal Antibody [Clone ID: OTI7B3]
TA807513S 30 µL

BMF Mouse Monoclonal Antibody [Clone ID: OTI7B3]

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS621523 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
TRAJ56 ORF Vector (Human) (pORF)
47493011 1.0 µg DNA

TRAJ56 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Sct sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3727405 3x 1.0 µg

Sct sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
hnRNP A0 Antibody
abx215970-01 50 µg

hnRNP A0 Antibody

Sign In for Pricing
View Details
hnRNP A0 Antibody
abx215970-02 100 µg

hnRNP A0 Antibody

Sign In for Pricing
View Details