Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TESPA1 Peptide - C-terminal region

TESPA1 Peptide - C-terminal region

Product Specifications

UniProt

A2RU30

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TESPA1 Rabbit Polyclonal Antibody (orb327011) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005269304

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLPIEDPQWSTDPAQIRRELCSLPATNTETHPAKDETFWKRKSRARKSLF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CD200 Protein, His, E.coli-1mg
QP11312-HIS-EC-1mg 1mg

Recombinant Human CD200 Protein, His, E.coli-1mg

Sign In for Pricing
View Details
Recombinant Human ADP-ribosylation factor-like protein 5B (ARL5B)
MBS1486186-01 0.02 mg (E-Coli)

Recombinant Human ADP-ribosylation factor-like protein 5B (ARL5B)

Sign In for Pricing
View Details
Recombinant Human ADP-ribosylation factor-like protein 5B (ARL5B)
MBS1486186-02 0.1 mg (E-Coli)

Recombinant Human ADP-ribosylation factor-like protein 5B (ARL5B)

Sign In for Pricing
View Details
Recombinant Human ADP-ribosylation factor-like protein 5B (ARL5B)
MBS1486186-03 0.02 mg (Yeast)

Recombinant Human ADP-ribosylation factor-like protein 5B (ARL5B)

Sign In for Pricing
View Details
Recombinant Human ADP-ribosylation factor-like protein 5B (ARL5B)
MBS1486186-04 0.1 mg (Yeast)

Recombinant Human ADP-ribosylation factor-like protein 5B (ARL5B)

Sign In for Pricing
View Details
Recombinant Human ADP-ribosylation factor-like protein 5B (ARL5B)
MBS1486186-05 0.02 mg (Baculovirus)

Recombinant Human ADP-ribosylation factor-like protein 5B (ARL5B)

Sign In for Pricing
View Details