Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPS18C Peptide - N-terminal region

MRPS18C Peptide - N-terminal region

Product Specifications

Product Name Alternative

MRP-S18-1, MRPS18-1

UniProt

Q9Y3D5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPS18C Rabbit Polyclonal Antibody (orb587545) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057151

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GTHTVLWRRGCSQQVSSNEDLPISMENPYKEPLKKCILCGKHVDYKNVQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP38 Human Gene Knockout Kit (CRISPR)
KN208974BN 1 Kit

USP38 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GM2A (NM_001167607) Human Over-expression Lysate
LY432647 100 µg

GM2A (NM_001167607) Human Over-expression Lysate

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Human CD44 Antibody[HI44a]
AN00335P-01 20 Tests

PE/Elab Fluor® 594 Anti-Human CD44 Antibody[HI44a]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Human CD44 Antibody[HI44a]
AN00335P-02 100 Tests

PE/Elab Fluor® 594 Anti-Human CD44 Antibody[HI44a]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Human CD44 Antibody[HI44a]
AN00335P-03 2x 100 Tests

PE/Elab Fluor® 594 Anti-Human CD44 Antibody[HI44a]

Sign In for Pricing
View Details
3-Nitropropionic Acid
TRC-N519753-5G 5 g

3-Nitropropionic Acid

Sign In for Pricing
View Details